Website Uptime Monitor

Monitor website availability and server information for any domain

letsplayepicwingamelegend.click

Uptime & Server Information

Current Status

Status
Active
Server Type
openresty
Page Title
porkbun.com | domain for sale
Meta Description
Not available
Meta Keywords
Not available
Last Checked
just now
Last Status Change
No change observed
Last Downtime
Never observed down

Observed Changes

DateStatusServer
9/30/2026, 12:44:38 PMActiveopenresty

Don't just check uptime once — watch it 24/7

This is a one-time check. Turn on monitoring and we'll watch the domains that matter to you continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor uptime free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

About Website Uptime Monitoring

Use the Who.is uptime information to track the availability and server information of websites. This helps track:

  • Website availability and response status
  • Server software and configuration
  • Meta information including titles and descriptions
  • Historical uptime patterns

This information is valuable for website owners, system administrators, and anyone interested in monitoring website reliability and performance.

What this page reports

  • Last status change: When we last saw a site switch between reachable and unreachable
  • Last downtime: When a site was most recently seen down, and whether it has come back
  • Server and meta information: The server software, page title and meta tags we last observed

We check a domain at most once a day and record an observation only when something changes, so these are the times a change was seen rather than the exact moment it happened. For continuous, minute-by-minute checks with alerting, use website monitoring.


Disclaimer: Who.is is not affiliated with, endorsed by, or connected to any of the domains displayed on this page. We provide this information as a public service for informational purposes only.