RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain letsplayepicwingamelegend.click is registered. You can still try to buy it here.
Domain Contacts
Registrant Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-49903589
- Kind
- organization
- https://porkbun [dot] com/whois/contact/registrant/letsplayepicwingamelegend [dot] click
- Phone
- tel:+1.9712673237
- Address
- 500 Westover Dr Pmb 9816, Sanford, North Carolina, 27330
- Country
- United States
Administrative Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-49903590
- Kind
- organization
- https://porkbun [dot] com/whois/contact/admin/letsplayepicwingamelegend [dot] click
- Phone
- tel:+1.9712673237
- Address
- 500 Westover Dr Pmb 9816, Sanford, North Carolina, 27330
- Country
- United States
Technical Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-49903591
- Kind
- organization
- https://porkbun [dot] com/whois/contact/tech/letsplayepicwingamelegend [dot] click
- Phone
- tel:+1.9712673237
- Address
- 500 Westover Dr Pmb 9816, Sanford, North Carolina, 27330
- Country
- United States
Billing Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-49903592
- Kind
- organization
- https://porkbun [dot] com/whois/contact/billing/letsplayepicwingamelegend [dot] click
- Phone
- tel:+1.9712673237
- Address
- 500 Westover Dr Pmb 9816, Sanford, North Carolina, 27330
- Country
- United States
Registrar Information
- Name
- Porkbun LLC
- Handle
- 1861
- Kind
- organization
- Public ID
- 1861
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- Abuse Department
- Handle
- 1
- Kind
- organization
- abuse [at] porkbun [dot] com
- Phone
- tel:+1.8557675286
Basic Information
- Handle
- DO_0fc8b9585e6f68fe9596abf73b11ccd4-UR
- Status
- client transfer prohibited, client delete prohibited, auto renew period
- Resource URL
- https://rdap.registry.click/rdap/domain/letsplayepicwingamelegend.click
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
- Registrar expiration
RDAP data last fetched
Nameservers
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.