DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
letsplayepicwingamelegend.click
DNS Records
Hosting & Network
letsplayepicwingamelegend.click runs on Amazon AWS.
- Hosting network
- Amazon AWSAS16509Amazon AWS
- Managed DNS
- Self-hosted / other
- None
- IPv6 (AAAA)
- Not enabled
- CAA pinning
- None
Sits alongside 4,561,298 other sites on Amazon AWS. Stable here since we started watching (Sep 30, 2026).
The apex and www are the same hosting — the apex via A records, www via a CNAME to pixie.porkbun.com.
DNS Records for letsplayepicwingamelegend.click
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| letsplayepicwingamelegend.click | SOA | 1800 | curitiba.ns.porkbun.com dns.cloudflare.com 2415632907 10000 2400 604800 1800 | |
| letsplayepicwingamelegend.click | NS | 0 | salvador.ns.porkbun.com | |
| letsplayepicwingamelegend.click | NS | 0 | maceio.ns.porkbun.com | |
| letsplayepicwingamelegend.click | NS | 0 | fortaleza.ns.porkbun.com | |
| letsplayepicwingamelegend.click | NS | 0 | curitiba.ns.porkbun.com | |
| letsplayepicwingamelegend.click | A | 0 | 207.207.210.229 | |
| letsplayepicwingamelegend.click | A | 0 | 207.207.210.107 | |
| www.letsplayepicwingamelegend.click | CNAME | 0 | pixie.porkbun.com | |
| www.letsplayepicwingamelegend.click | A | 0 | 207.207.210.107 | |
| www.letsplayepicwingamelegend.click | A | 0 | 207.207.210.229 |
Get alerted the moment letsplayepicwingamelegend.click's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch letsplayepicwingamelegend.click continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about letsplayepicwingamelegend.click
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain