DNS Record Lookup

Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain

letsplayepicwingamelegend.click

DNS Records

Hosting & Network

letsplayepicwingamelegend.click runs on Amazon AWS.

Hosting network
Amazon AWSAS16509Amazon AWS
Managed DNS
Self-hosted / other
Email
None
IPv6 (AAAA)
Not enabled
CAA pinning
None

Sits alongside 4,561,298 other sites on Amazon AWS. Stable here since we started watching (Sep 30, 2026).

The apex and www are the same hosting — the apex via A records, www via a CNAME to pixie.porkbun.com.

DNS Records for letsplayepicwingamelegend.click

HostnameTypeTTLPriorityContent
letsplayepicwingamelegend.clickSOA1800curitiba.ns.porkbun.com dns.cloudflare.com 2415632907 10000 2400 604800 1800
letsplayepicwingamelegend.clickNS0salvador.ns.porkbun.com
letsplayepicwingamelegend.clickNS0maceio.ns.porkbun.com
letsplayepicwingamelegend.clickNS0fortaleza.ns.porkbun.com
letsplayepicwingamelegend.clickNS0curitiba.ns.porkbun.com
letsplayepicwingamelegend.clickA0207.207.210.229
letsplayepicwingamelegend.clickA0207.207.210.107
www.letsplayepicwingamelegend.clickCNAME0pixie.porkbun.com
www.letsplayepicwingamelegend.clickA0207.207.210.107
www.letsplayepicwingamelegend.clickA0207.207.210.229

Get alerted the moment letsplayepicwingamelegend.click's DNS changes

This page is today's snapshot. Turn on monitoring and we'll watch letsplayepicwingamelegend.click continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor DNS free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

What's up with DNS →

Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.

Ask about letsplayepicwingamelegend.click

Beta

Answers use the live DNS records shown on this page. AI-generated — double-check anything important.

About DNS Records

DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:

  • SOA (Start of Authority) - Contains administrative information about the zone
  • NS (Nameserver) - Specifies authoritative nameservers for the domain
  • A (Address) - Maps a domain to an IPv4 address
  • AAAA - Maps a domain to an IPv6 address
  • CNAME (Canonical Name) - Creates an alias pointing to another domain
  • MX (Mail Exchange) - Specifies mail servers for the domain