SSL/TLS Certificate Lookup
Check a domain's SSL/TLS certificate — who issued it, when it expires, and whether the chain is trusted
letsplayepicwingamelegend.click
SSL/TLS Certificate
SSL/TLS Certificate for letsplayepicwingamelegend.click
Valid- Issued by (CA)
- Let's Encrypt
- Subject
- letsplayepicwingamelegend.click
- Valid from
- Sep 23, 2026
- Valid until
- Dec 22, 2026 (80 days remaining)
- Public key
- EC 256-bit
- Serial
- 0623B73AF20F3A51DA8B7256985F307DE3F1
- SHA-256 fingerprint
- 19:1C:65:85:55:CE:74:51:3D:7F:A8:AE:35:C8:F5:0A:05:43:26:9B:AA:4B:0E:1B:03:5E:1D:5B:62:C8:F5:C0
- Chain
- YE2 → Root YE → ISRG Root X2 → ISRG Root X1
Certificate Authority Authorization (CAA)
No CAA policy is published for this domain — any certificate authority may issue for it.
Never get surprised by letsplayepicwingamelegend.click's certificate expiring
This is today's certificate. Turn on monitoring and we'll watch letsplayepicwingamelegend.click continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.