Website Uptime Monitor

Monitor website availability and server information for any domain

kadiyalisrimahishamardinitempledevelopmentcommittee.com

Uptime & Server Information

Current Status

Status
Active
Server Type
cloudflare
Page Title
Not available
Meta Description
Not available
Meta Keywords
Not available
Most Recent Data
0 hours, 0 minutes ago

Historical Data

DateStatusServer
8/10/2026, 5:23:18 AMActivecloudflare
5/6/2026, 3:48:17 AMActivecloudflare
2/19/2026, 11:27:00 PMInactiveUnknown
2/12/2026, 5:45:10 AMInactiveUnknown
2/8/2026, 4:38:12 PMInactiveUnknown
1/25/2026, 12:21:54 AMActivenginx/1.14.1

Don't just check uptime once — watch it 24/7

This is a one-time check. Turn on monitoring and we'll watch the domains that matter to you continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor uptime free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

About Website Uptime Monitoring

Use the Who.is uptime information to track the availability and server information of websites. This helps track:

  • Website availability and response status
  • Server software and configuration
  • Meta information including titles and descriptions
  • Historical uptime patterns

This information is valuable for website owners, system administrators, and anyone interested in monitoring website reliability and performance.

Metrics we monitor

  • Uptime percentage: The percentage of time your website is accessible
  • Response time: How quickly your server responds to requests
  • Status codes: HTTP response codes indicating server status

Disclaimer: Who.is is not affiliated with, endorsed by, or connected to any of the domains displayed on this page. We provide this information as a public service for informational purposes only.