DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
kadiyalisrimahishamardinitempledevelopmentcommittee.com
DNS Records
Hosting & Network
kadiyalisrimahishamardinitempledevelopmentcommittee.com runs on Cloudflare, with DNS by Cloudflare.
- Hosting network
- CloudflareAS13335Cloudflare
- Managed DNS
- Cloudflare
- None
- IPv6 (AAAA)
- Enabled
- CAA pinning
- None
Sits alongside 4,999+ other sites on Cloudflare. Stable here since we started watching (Aug 10, 2026).
The apex and www are the same hosting — the apex via A records.
DNS Records for kadiyalisrimahishamardinitempledevelopmentcommittee.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | A | 0 | 104.21.86.35 | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | A | 0 | 172.67.214.122 | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | NS | 0 | arturo.ns.cloudflare.com | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | NS | 0 | val.ns.cloudflare.com | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | SOA | 1800 | arturo.ns.cloudflare.com dns.cloudflare.com 2410860077 10000 2400 604800 1800 | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | AAAA | 0 | 2606:4700:3035::6815:5623 | |
| kadiyalisrimahishamardinitempledevelopmentcommittee.com | AAAA | 0 | 2606:4700:3034::ac43:d67a | |
| www.kadiyalisrimahishamardinitempledevelopmentcommittee.com | AAAA | 0 | 2606:4700:3035::6815:5623 | |
| www.kadiyalisrimahishamardinitempledevelopmentcommittee.com | AAAA | 0 | 2606:4700:3034::ac43:d67a | |
| www.kadiyalisrimahishamardinitempledevelopmentcommittee.com | A | 0 | 172.67.214.122 | |
| www.kadiyalisrimahishamardinitempledevelopmentcommittee.com | A | 0 | 104.21.86.35 |
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about kadiyalisrimahishamardinitempledevelopmentcommittee.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
Get alerted the moment kadiyalisrimahishamardinitempledevelopmentcommittee.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch kadiyalisrimahishamardinitempledevelopmentcommittee.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain