RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
vindhyamahashaktisewasansthan.com
RDAP Information
vindhyamahashaktisewasansthan.com is registered but parked. If it’s yours, use BotBuilt to launch your site in minutes — just describe what you want. If it isn’t, you can still try to buy it here.
Domain Contacts
Registrant Contact
- Contact URI
- https://www.hostinger.com/whois?domain=vindhyamahashaktisewasansthan.com&view=contact
Registrar Information
- Name
- HOSTINGER operations, UAB
- Handle
- 1636
- Public ID
- 1636
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- Registrar Abuse Contact
- abuse [at] hostinger [dot] com
- Phone
- tel:+1-212-252-2172
Basic Information
- Handle
- 3000360769_DOMAIN_COM-VRSN
- Status
- client transfer prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/vindhyamahashaktisewasansthan.com
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
- Registrar expiration
RDAP data last fetched
Nameservers
| Hostname | IP Address |
|---|---|
| ns1.dns-parking.com | 162.159.24.201 |
| ns2.dns-parking.com | 162.159.25.42 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.