DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
vindhyamahashaktisewasansthan.com
DNS Records
Hosting & Network
vindhyamahashaktisewasansthan.com isn’t pointed at a host yet — it has nameservers configured but no A/AAAA records for us to trace to a hosting network.
- Managed DNS
- a domain-parking service
- None
vindhyamahashaktisewasansthan.com has no website behind it yet. Use BotBuilt to launch your site in minutes — just describe what you want and your site is live.
DNS Records for vindhyamahashaktisewasansthan.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| vindhyamahashaktisewasansthan.com | SOA | 600 | ns1.dns-parking.com dns.hostinger.com 2026092401 10000 2400 604800 600 | |
| vindhyamahashaktisewasansthan.com | NS | 0 | ns1.dns-parking.com | |
| vindhyamahashaktisewasansthan.com | NS | 0 | ns2.dns-parking.com | |
| www.vindhyamahashaktisewasansthan.com | NS | 0 | ns2.dns-parking.com | |
| www.vindhyamahashaktisewasansthan.com | NS | 0 | ns1.dns-parking.com | |
| www.vindhyamahashaktisewasansthan.com | SOA | 600 | ns1.dns-parking.com dns.hostinger.com 2026092401 10000 2400 604800 600 | |
| www.vindhyamahashaktisewasansthan.com | CNAME | 0 | vindhyamahashaktisewasansthan.com |
Get alerted the moment vindhyamahashaktisewasansthan.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch vindhyamahashaktisewasansthan.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about vindhyamahashaktisewasansthan.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain