RDAP Domain Lookup

Look up structured registration data for domains using the Registration Data Access Protocol

steadmanhawkinsclinicdenverfellowship.org

RDAP Information

IP Address: 54.160.137.56

The domain steadmanhawkinsclinicdenverfellowship.org is registered. You can still try to buy it here.

Registrar Information

Name
GoDaddy.com, LLC
Handle
146
Public ID
146
Public ID Type
IANA Registrar ID

Registrar Contacts

Abuse Contact

Email
abuse [at] godaddy [dot] com
Phone
tel:+1.4806242505

Basic Information

Status
client delete prohibited, client renew prohibited, client transfer prohibited, client update prohibited
Resource URL
https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org

Important Dates

Expiration
1/21/2027
Registration
1/21/2021
Last changed
3/7/2025
Last update of RDAP database
12/15/2025

Raw RDAP Data

Raw RDAP responses from registry and registrar servers.

{
  "links": [
    {
      "rel": "related",
      "href": "https://rdap.godaddy.com/v1/domain/steadmanhawkinsclinicdenverfellowship.org",
      "type": "application/rdap+json",
      "value": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org"
    },
    {
      "rel": "self",
      "href": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org",
      "type": "application/rdap+json",
      "value": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org"
    }
  ],
  "events": [
    {
      "eventDate": "2027-01-21T13:07:04.871Z",
      "eventAction": "expiration"
    },
    {
      "eventDate": "2021-01-21T13:07:04.871Z",
      "eventAction": "registration"
    },
    {
      "eventDate": "2025-03-07T13:07:53.751Z",
      "eventAction": "last changed"
    },
    {
      "eventDate": "2025-12-15T21:45:02.48Z",
      "eventAction": "last update of RDAP database"
    }
  ],
  "status": [
    "client delete prohibited",
    "client renew prohibited",
    "client transfer prohibited",
    "client update prohibited"
  ],
  "ldhName": "steadmanhawkinsclinicdenverfellowship.org",
  "notices": [
    {
      "links": [
        {
          "rel": "terms-of-service",
          "href": "https://thenew.org/org-people/about-pir/policies/",
          "type": "text/html",
          "value": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org"
        }
      ],
      "title": "Terms of Service",
      "description": [
        "Public Interest Registry provides this RDAP service for informational purposes only, and to assist persons in obtaining information about or related to a domain name registration record. Public Interest Registry does not guarantee its accuracy. Users accessing the Public Interest Registry RDAP service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Public Interest Registry or any ICANN-accredited registrar, except as reasonably necessary to register domain names or modify existing registrations. When using the Public Interest Registry RDAP service, please consider the following: the RDAP service is not a replacement for standard EPP commands to the SRS service. RDAP is not considered authoritative for registered domain objects. The RDAP service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the RDAP services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of RDAP service access. Abuse of the RDAP system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the RDAP records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data can be requested by submitting a request to WHOISrequest@pir.org. Public Interest Registry Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy."
      ]
    },
    {
      "links": [
        {
          "rel": "glossary",
          "href": "https://icann.org/epp",
          "type": "application/rdap+json",
          "value": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org"
        }
      ],
      "title": "Status Codes",
      "description": [
        "For more information on domain status codes, please visit https://icann.org/epp"
      ]
    },
    {
      "links": [
        {
          "rel": "help",
          "href": "https://icann.org/wicf",
          "type": "application/rdap+json",
          "value": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org"
        }
      ],
      "title": "RDDS Inaccuracy Complaint Form",
      "description": [
        "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
      ]
    }
  ],
  "entities": [
    {
      "roles": [
        "registrar"
      ],
      "handle": "146",
      "entities": [
        {
          "roles": [
            "abuse"
          ],
          "vcardArray": [
            "vcard",
            [
              [
                "version",
                {},
                "text",
                "4.0"
              ],
              [
                "fn",
                {},
                "text",
                ""
              ],
              [
                "tel",
                {
                  "type": "voice"
                },
                "uri",
                "tel:+1.4806242505"
              ],
              [
                "email",
                {},
                "text",
                "abuse@godaddy.com"
              ]
            ]
          ],
          "objectClassName": "entity"
        }
      ],
      "publicIds": [
        {
          "type": "IANA Registrar ID",
          "identifier": "146"
        }
      ],
      "vcardArray": [
        "vcard",
        [
          [
            "version",
            {},
            "text",
            "4.0"
          ],
          [
            "fn",
            {},
            "text",
            "GoDaddy.com, LLC"
          ]
        ]
      ],
      "objectClassName": "entity"
    }
  ],
  "secureDNS": {
    "delegationSigned": false
  },
  "nameservers": [
    {
      "ldhName": "ns7.yourpracticeonline.com",
      "objectClassName": "nameserver"
    },
    {
      "ldhName": "ns8.yourpracticeonline.com",
      "objectClassName": "nameserver"
    }
  ],
  "queried_url": "https://rdap.publicinterestregistry.org/rdap/domain/steadmanhawkinsclinicdenverfellowship.org",
  "objectClassName": "domain",
  "rdapConformance": [
    "rdap_level_0",
    "icann_rdap_response_profile_1",
    "icann_rdap_technical_implementation_guide_1",
    "redacted"
  ]
}

About RDAP

The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.

RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.