DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
steadmanhawkinsclinicdenverfellowship.org
DNS Records
DNS Records for steadmanhawkinsclinicdenverfellowship.org
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| steadmanhawkinsclinicdenverfellowship.org | SOA | 86400 | ns7.yourpracticeonline.com root.ns7.yourpracticeonline.com 2025120401 3600 1800 1209600 86400 | |
| steadmanhawkinsclinicdenverfellowship.org | NS | 0 | ns8.yourpracticeonline.com | |
| steadmanhawkinsclinicdenverfellowship.org | NS | 0 | ns7.yourpracticeonline.com | |
| steadmanhawkinsclinicdenverfellowship.org | MX | 0 | steadmanhawkinsclinicdenverfellowship.org | |
| steadmanhawkinsclinicdenverfellowship.org | A | 0 | 54.160.137.56 | |
| www.steadmanhawkinsclinicdenverfellowship.org | SOA | 86400 | ns7.yourpracticeonline.com root.ns7.yourpracticeonline.com 2025120401 3600 1800 1209600 86400 | |
| www.steadmanhawkinsclinicdenverfellowship.org | CNAME | 0 | steadmanhawkinsclinicdenverfellowship.org | |
| www.steadmanhawkinsclinicdenverfellowship.org | MX | 0 | steadmanhawkinsclinicdenverfellowship.org | |
| www.steadmanhawkinsclinicdenverfellowship.org | A | 0 | 54.160.137.56 | |
| www.steadmanhawkinsclinicdenverfellowship.org | NS | 0 | ns7.yourpracticeonline.com | |
| www.steadmanhawkinsclinicdenverfellowship.org | NS | 0 | ns8.yourpracticeonline.com |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain