RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain glassreplacementservicenewmarket.com is registered. You can still try to buy it here.
Domain Contacts
Registrant Contact
- Organization
- Privacy service provided by WITHHELD FOR PRIVACY LLC
- Handle
- 1bb303bd32ae4fb8e38b08db4f0edd96-Namech
- db0a98c806d142f5b4d38fc78d7f3667 [dot] protect [at] withheldforprivacy [dot] com
- Phone
- tel:+1.3022061391
- Address
- 16192 Coastal Highway, Lewes, Delaware, 19958
- Country
- United States
Technical Contact
- Organization
- Privacy service provided by WITHHELD FOR PRIVACY LLC
- Handle
- 0f88088f421b4252912f08db4f11c42e-Namech
- db0a98c806d142f5b4d38fc78d7f3667 [dot] protect [at] withheldforprivacy [dot] com
- Phone
- tel:+1.3022061391
- Address
- 16192 Coastal Highway, Lewes, Delaware, 19958
- Country
- United States
Registrar Information
- Name
- NAMECHEAP INC
- Handle
- 1068
- Public ID
- 1068
- Public ID Type
- IANA Registrar ID
- support [at] namecheap [dot] com
- Phone
- tel:+1.6613102107
Registrar Contacts
Abuse Contact
- Name
- NAMECHEAP INC
- abuse [at] namecheap [dot] com
- Phone
- tel:+1.9854014545
Basic Information
- Handle
- 2779009506_DOMAIN_COM-VRSN
- Status
- client transfer prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/glassreplacementservicenewmarket.com
Important Dates
- Registration
- Expiration
- Last changed
- Last update of RDAP database
- Registrar expiration
RDAP data last fetched
Nameservers
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.