DNS Record Lookup

Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain

glassreplacementservicenewmarket.com

DNS Records

Hosting & Network

glassreplacementservicenewmarket.com runs on AS40092, with email configured.

Hosting network
AS40092AS40092
Managed DNS
Self-hosted / other
Email
Configured
IPv6 (AAAA)
Not enabled
CAA pinning
Set

Sits alongside 29,629 other sites on AS40092. Stable here since we started watching (Sep 25, 2026).

The apex and www are the same hosting — the apex via A records, www via a CNAME to glassreplacementservicenewmarket.com.

DNS Records for glassreplacementservicenewmarket.com

HostnameTypeTTLPriorityContent
glassreplacementservicenewmarket.comA0208.79.219.210
glassreplacementservicenewmarket.comMX0glassreplacementservicenewmarket.com
glassreplacementservicenewmarket.comTXT0v=spf1 +a +mx +ip4:66.102.137.106 +include:spf.servername.online ~all
glassreplacementservicenewmarket.comSOA86400ns1.208-79-219-210.cprapid.com root.208-79-219-210.cprapid.com 2026081001 3600 1800 1209600 86400
glassreplacementservicenewmarket.comCAA00 issue sectigo.com
glassreplacementservicenewmarket.comCAA00 issue pki.goog
glassreplacementservicenewmarket.comCAA00 issuewild sectigo.com
glassreplacementservicenewmarket.comCAA00 issuewild pki.goog
glassreplacementservicenewmarket.comCAA00 issue letsencrypt.org
glassreplacementservicenewmarket.comCAA00 issuewild globalsign.com
glassreplacementservicenewmarket.comCAA00 issue globalsign.com
glassreplacementservicenewmarket.comCAA00 issuewild letsencrypt.org
glassreplacementservicenewmarket.comNS0ns2.208-79-219-210.cprapid.com
glassreplacementservicenewmarket.comNS0ns1.208-79-219-210.cprapid.com
www.glassreplacementservicenewmarket.comA0208.79.219.210
www.glassreplacementservicenewmarket.comCNAME0glassreplacementservicenewmarket.com
www.glassreplacementservicenewmarket.comTXT0v=spf1 +a +mx +ip4:66.102.137.106 +include:spf.servername.online ~all
www.glassreplacementservicenewmarket.comSOA86400ns1.208-79-219-210.cprapid.com root.208-79-219-210.cprapid.com 2026081001 3600 1800 1209600 86400
www.glassreplacementservicenewmarket.comNS0ns1.208-79-219-210.cprapid.com
www.glassreplacementservicenewmarket.comNS0ns2.208-79-219-210.cprapid.com
www.glassreplacementservicenewmarket.comMX0glassreplacementservicenewmarket.com
www.glassreplacementservicenewmarket.comCAA00 issuewild letsencrypt.org
www.glassreplacementservicenewmarket.comCAA00 issuewild pki.goog
www.glassreplacementservicenewmarket.comCAA00 issue letsencrypt.org
www.glassreplacementservicenewmarket.comCAA00 issue pki.goog
www.glassreplacementservicenewmarket.comCAA00 issue globalsign.com
www.glassreplacementservicenewmarket.comCAA00 issuewild sectigo.com
www.glassreplacementservicenewmarket.comCAA00 issuewild globalsign.com
www.glassreplacementservicenewmarket.comCAA00 issue sectigo.com

Get alerted the moment glassreplacementservicenewmarket.com's DNS changes

This page is today's snapshot. Turn on monitoring and we'll watch glassreplacementservicenewmarket.com continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor DNS free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

What's up with DNS →

Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.

Ask about glassreplacementservicenewmarket.com

Beta

Answers use the live DNS records shown on this page. AI-generated — double-check anything important.

About DNS Records

DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:

  • SOA (Start of Authority) - Contains administrative information about the zone
  • NS (Nameserver) - Specifies authoritative nameservers for the domain
  • A (Address) - Maps a domain to an IPv4 address
  • AAAA - Maps a domain to an IPv6 address
  • CNAME (Canonical Name) - Creates an alias pointing to another domain
  • MX (Mail Exchange) - Specifies mail servers for the domain