DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
glassreplacementservicenewmarket.com
DNS Records
Hosting & Network
glassreplacementservicenewmarket.com runs on AS40092, with email configured.
- Hosting network
- AS40092AS40092
- Managed DNS
- Self-hosted / other
- Configured
- IPv6 (AAAA)
- Not enabled
- CAA pinning
- Set
Sits alongside 29,629 other sites on AS40092. Stable here since we started watching (Sep 25, 2026).
The apex and www are the same hosting — the apex via A records, www via a CNAME to glassreplacementservicenewmarket.com.
DNS Records for glassreplacementservicenewmarket.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| glassreplacementservicenewmarket.com | A | 0 | 208.79.219.210 | |
| glassreplacementservicenewmarket.com | MX | 0 | glassreplacementservicenewmarket.com | |
| glassreplacementservicenewmarket.com | TXT | 0 | v=spf1 +a +mx +ip4:66.102.137.106 +include:spf.servername.online ~all | |
| glassreplacementservicenewmarket.com | SOA | 86400 | ns1.208-79-219-210.cprapid.com root.208-79-219-210.cprapid.com 2026081001 3600 1800 1209600 86400 | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issue sectigo.com | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issue pki.goog | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild sectigo.com | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild pki.goog | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issue letsencrypt.org | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild globalsign.com | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issue globalsign.com | |
| glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild letsencrypt.org | |
| glassreplacementservicenewmarket.com | NS | 0 | ns2.208-79-219-210.cprapid.com | |
| glassreplacementservicenewmarket.com | NS | 0 | ns1.208-79-219-210.cprapid.com | |
| www.glassreplacementservicenewmarket.com | A | 0 | 208.79.219.210 | |
| www.glassreplacementservicenewmarket.com | CNAME | 0 | glassreplacementservicenewmarket.com | |
| www.glassreplacementservicenewmarket.com | TXT | 0 | v=spf1 +a +mx +ip4:66.102.137.106 +include:spf.servername.online ~all | |
| www.glassreplacementservicenewmarket.com | SOA | 86400 | ns1.208-79-219-210.cprapid.com root.208-79-219-210.cprapid.com 2026081001 3600 1800 1209600 86400 | |
| www.glassreplacementservicenewmarket.com | NS | 0 | ns1.208-79-219-210.cprapid.com | |
| www.glassreplacementservicenewmarket.com | NS | 0 | ns2.208-79-219-210.cprapid.com | |
| www.glassreplacementservicenewmarket.com | MX | 0 | glassreplacementservicenewmarket.com | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild letsencrypt.org | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild pki.goog | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issue letsencrypt.org | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issue pki.goog | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issue globalsign.com | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild sectigo.com | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issuewild globalsign.com | |
| www.glassreplacementservicenewmarket.com | CAA | 0 | 0 issue sectigo.com |
Get alerted the moment glassreplacementservicenewmarket.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch glassreplacementservicenewmarket.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about glassreplacementservicenewmarket.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain