DNS Record Lookup

Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain

antalyahavalimaniviptransfer.com

DNS Records

Hosting & Network

antalyahavalimaniviptransfer.com runs on AS3188, with email configured.

Hosting network
AS3188AS3188
Managed DNS
Self-hosted / other
Email
Configured
IPv6 (AAAA)
Not enabled
CAA pinning
None

Sits alongside 3,546 other sites on AS3188. Stable here since we started watching (Aug 15, 2026).

The apex and www are the same hosting — the apex via A records.

DNS Records for antalyahavalimaniviptransfer.com

HostnameTypeTTLPriorityContent
antalyahavalimaniviptransfer.comNS0ns2.antalyahavalimaniviptransfer.com
antalyahavalimaniviptransfer.comNS0ns1.antalyahavalimaniviptransfer.com
antalyahavalimaniviptransfer.comSOA1800ns1.antalyahavalimaniviptransfer.com hostmaster.antalyahavalimaniviptransfer.com 2026090105 3600 3600 1209600 1800
antalyahavalimaniviptransfer.comTXT0v=spf1 include:mxroute.com -all
antalyahavalimaniviptransfer.comMX020fusion-relay.mxrouting.net
antalyahavalimaniviptransfer.comMX010fusion.mxrouting.net
antalyahavalimaniviptransfer.comA0185.8.131.117
www.antalyahavalimaniviptransfer.comA0185.8.131.117

What's up with DNS →

Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.

Ask about antalyahavalimaniviptransfer.com

Beta

Answers use the live DNS records shown on this page. AI-generated — double-check anything important.

Get alerted the moment antalyahavalimaniviptransfer.com's DNS changes

This page is today's snapshot. Turn on monitoring and we'll watch antalyahavalimaniviptransfer.com continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor DNS free

Free for your first domain: uptime, DNS, and certificate together. No credit card.

About DNS Records

DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:

  • SOA (Start of Authority) - Contains administrative information about the zone
  • NS (Nameserver) - Specifies authoritative nameservers for the domain
  • A (Address) - Maps a domain to an IPv4 address
  • AAAA - Maps a domain to an IPv6 address
  • CNAME (Canonical Name) - Creates an alias pointing to another domain
  • MX (Mail Exchange) - Specifies mail servers for the domain