Name Server Information Search

Look up information about nameservers, including their IP addresses and the domains they serve

NS1.ANTALYAHAVALIMANIVIPTRANSFER.COM

IP Address
185.8.131.117
Parent Domain
antalyahavalimaniviptransfer.com (WHOIS | DNS | RDAP)
Total Domains
7

About Nameservers

Nameservers are essential components of the Domain Name System (DNS) that store and maintain DNS records for domains. They translate human-readable domain names into IP addresses that computers use to communicate. Each domain typically has multiple nameservers for redundancy and reliability.

When you look up a nameserver, you can see its IP addresses and a sample of the domains it manages. This helps understand the infrastructure supporting various domains.