RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain sttammanyparishtraffictickets.com is registered. You can still try to buy it here.
Registrar Information
- Name
- GoDaddy.com, LLC
- Handle
- 146
- Public ID
- 146
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- abuse [at] godaddy [dot] com
- Phone
- tel:480-624-2505
Basic Information
- Handle
- 1718042428_DOMAIN_COM-VRSN
- Status
- client delete prohibited, client renew prohibited, client transfer prohibited, client update prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/sttammanyparishtraffictickets.com
Important Dates
- Registration
- 5/4/2012
- Expiration
- 1/29/2035
- Last changed
- 5/23/2025
- Last update of RDAP database
- 12/17/2025
Nameservers
| Hostname | IP Address |
|---|---|
| NS1.FREMONTINFO.NET | 161.35.238.111 |
| NS2.FREMONTINFO.NET | 67.205.187.208 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
{
"links": [
{
"rel": "self",
"href": "https://rdap.verisign.com/com/v1/domain/STTAMMANYPARISHTRAFFICTICKETS.COM",
"type": "application/rdap+json",
"value": "https://rdap.verisign.com/com/v1/domain/STTAMMANYPARISHTRAFFICTICKETS.COM"
},
{
"rel": "related",
"href": "https://rdap.godaddy.com/v1/domain/STTAMMANYPARISHTRAFFICTICKETS.COM",
"type": "application/rdap+json",
"value": "https://rdap.godaddy.com/v1/domain/STTAMMANYPARISHTRAFFICTICKETS.COM"
}
],
"events": [
{
"eventDate": "2012-05-04T15:53:06Z",
"eventAction": "registration"
},
{
"eventDate": "2035-01-29T11:59:59Z",
"eventAction": "expiration"
},
{
"eventDate": "2025-05-23T23:08:31Z",
"eventAction": "last changed"
},
{
"eventDate": "2025-12-17T21:45:42Z",
"eventAction": "last update of RDAP database"
}
],
"handle": "1718042428_DOMAIN_COM-VRSN",
"status": [
"client delete prohibited",
"client renew prohibited",
"client transfer prohibited",
"client update prohibited"
],
"ldhName": "STTAMMANYPARISHTRAFFICTICKETS.COM",
"notices": [
{
"links": [
{
"rel": "terms-of-service",
"href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
"type": "text/html",
"value": "https://rdap.verisign.com/com/v1/domain/sttammanyparishtraffictickets.com"
}
],
"title": "Terms of Service",
"description": [
"Service subject to Terms of Use."
]
},
{
"links": [
{
"href": "https://icann.org/epp",
"type": "text/html"
}
],
"title": "Status Codes",
"description": [
"For more information on domain status codes, please visit https://icann.org/epp"
]
},
{
"links": [
{
"rel": "help",
"href": "https://icann.org/wicf",
"type": "text/html",
"value": "https://rdap.verisign.com/com/v1/domain/sttammanyparishtraffictickets.com"
}
],
"title": "RDDS Inaccuracy Complaint Form",
"description": [
"URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
]
}
],
"entities": [
{
"roles": [
"registrar"
],
"handle": "146",
"entities": [
{
"roles": [
"abuse"
],
"vcardArray": [
"vcard",
[
[
"version",
{},
"text",
"4.0"
],
[
"fn",
{},
"text",
""
],
[
"tel",
{
"type": "voice"
},
"uri",
"tel:480-624-2505"
],
[
"email",
{},
"text",
"abuse@godaddy.com"
]
]
],
"objectClassName": "entity"
}
],
"publicIds": [
{
"type": "IANA Registrar ID",
"identifier": "146"
}
],
"vcardArray": [
"vcard",
[
[
"version",
{},
"text",
"4.0"
],
[
"fn",
{},
"text",
"GoDaddy.com, LLC"
]
]
],
"objectClassName": "entity"
}
],
"secureDNS": {
"delegationSigned": false
},
"nameservers": [
{
"ldhName": "NS1.FREMONTINFO.NET",
"objectClassName": "nameserver"
},
{
"ldhName": "NS2.FREMONTINFO.NET",
"objectClassName": "nameserver"
}
],
"queried_url": "https://rdap.verisign.com/com/v1/domain/sttammanyparishtraffictickets.com",
"objectClassName": "domain",
"rdapConformance": [
"rdap_level_0",
"icann_rdap_technical_implementation_guide_1",
"icann_rdap_response_profile_1"
]
}About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.