RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain pathgainwaycapitaldeckview.help is registered. You can still try to buy it here.
Registrar Information
- Name
- Porkbun LLC
- Handle
- 1861
- Public ID
- 1861
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- Abuse Department
- Handle
- 1
- Kind
- organization
- abuse [at] porkbun [dot] com
- Phone
- tel:+1.8557675286
Domain Contacts
Registrant Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-9069
- Kind
- organization
- https://porkbun [dot] com/whois/contact/registrant/pathgainwaycapitaldeckview [dot] help
- Phone
- tel:+1.9712666028
- Address
- 500 Westover Dr #9816, Sanford, NC, 27330
Administrative Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-9070
- Kind
- organization
- https://porkbun [dot] com/whois/contact/admin/pathgainwaycapitaldeckview [dot] help
- Phone
- tel:+1.9712666028
- Address
- 500 Westover Dr #9816, Sanford, NC, 27330
Technical Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-9071
- Kind
- organization
- https://porkbun [dot] com/whois/contact/tech/pathgainwaycapitaldeckview [dot] help
- Phone
- tel:+1.9712666028
- Address
- 500 Westover Dr #9816, Sanford, NC, 27330
Billing Contact
- Name
- Whois Privacy
- Organization
- Private by Design, LLC
- Handle
- INTERNAL-9072
- Kind
- organization
- https://porkbun [dot] com/whois/contact/billing/pathgainwaycapitaldeckview [dot] help
- Phone
- tel:+1.9712666028
- Address
- 500 Westover Dr #9816, Sanford, NC, 27330
Basic Information
- Handle
- D574316700-CNIC
- Status
- client transfer prohibited, client delete prohibited
- Resource URL
- https://rdap.centralnic.com/help/domain/pathgainwaycapitaldeckview.help
Important Dates
- Registration
- 7/23/2025
- Expiration
- 7/23/2026
- Last update of RDAP database
- 7/23/2025
- Last changed
- 7/23/2025
- Registrar expiration
- 7/23/2026
Nameservers
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.