RDAP Domain Lookup
Look up structured registration data for domains using the Registration Data Access Protocol
The domain geetkarpanditvishweshwarsharma.com is registered. You can still try to buy it here.
Registrar Information
- Name
- PDR Ltd. d/b/a PublicDomainRegistry.com
- Handle
- 303
- Public ID
- 303
- Public ID Type
- IANA Registrar ID
Registrar Contacts
Abuse Contact
- Name
- PDR Ltd. d/b/a PublicDomainRegistry.com
- Organization
- PDR Ltd. d/b/a PublicDomainRegistry.com
- abuse-contact [at] publicdomainregistry [dot] com
- Phone
- tel:+1.2013775952
Domain Contacts
Administrative Contact
- Name
- Manan Shastri
- Organization
- N/A
- Kind
- individual
- mananshastri24 [at] gmail [dot] com
- Phone
- tel:+91.9413020885
- Address
- ,Udaipur,28 tamboli street moti chohtta, Udaipur, Rajasthan, 313001
Registrant Contact
- Name
- Manan Shastri
- Organization
- REDACTED FOR PRIVACY
- Kind
- individual
- mananshastri24 [at] gmail [dot] com
- Phone
- tel:+91.9413020885
- Address
- ,Udaipur,28 tamboli street moti chohtta, Udaipur, Rajasthan, 313001
Basic Information
- Handle
- 2144603640_DOMAIN_COM-VRSN
- Status
- client transfer prohibited
- Resource URL
- https://rdap.verisign.com/com/v1/domain/geetkarpanditvishweshwarsharma.com
Important Dates
- Registration
- 7/19/2017
- Expiration
- 7/19/2026
- Last changed
- 7/21/2025
- Last update of RDAP database
- 10/18/2025
Nameservers
Hostname | IP Address |
---|---|
ns125.hostingraja.org | 103.92.235.92 |
ns126.hostingraja.org | 103.92.235.92 |
Similar Domains
Raw RDAP Data
Raw RDAP responses from registry and registrar servers.
About RDAP
The Registration Data Access Protocol (RDAP) is a modern protocol designed to replace the traditional WHOIS protocol. It provides a standardized way to access domain registration data, offering more structured and secure data retrieval.
RDAP supports internationalization, secure access, and standardized responses, making it a more robust solution for accessing domain registration information.