Domain History Archive
See how many historical WHOIS/RDAP snapshots we hold for any domain — and unlock the full record.
daimlerchryslerfinancialservices.pl
Domain History
Full WHOIS history for daimlerchryslerfinancialservices.pl
28 snapshots spanning 2011–2025, often including registrant details no longer visible in current WHOIS.
Record updates counts the distinct dates the registry/registrar stamped this domain as last changed (renewals, nameserver, status, contact and ownership updates). The full report breaks these down into a deduplicated, field-by-field change timeline.
The full Domain History Report
A complete, normalized history of the domain: every snapshot we've recorded, turned into clean structured fields. Our archive goes back to 2007, so for many domains it captures registrant contact details no longer visible in current WHOIS.
What each snapshot in the report covers:
- Registrar — name, IANA ID, and URL
- Key dates — created, last updated, and expiry
- Nameservers, status codes, and DNSSEC
- Contacts captured separately for each role — registrant, admin, tech, billing, and abuse — with name, organization, email, phone, and postal address where present
- A deduplicated record-update timeline showing when each change occurred
Delivered as a .zip via a secure email link (valid 24 hours), containing:
- report.pdf — a readable report: the record-update timeline, followed by the full details of every snapshot
- snapshots.jsonl — one structured JSON record per snapshot, ready for spreadsheets or analysis
Example — the timeline in report.pdf for who.is:
2002-07-09 Network Solutions, LLC Nameservers: ns1.who.is, ns2.who.is Status: clienttransferprohibited Created 1995-02-09 Expires 2026-02-08 Registrant: who.is · Domain Administrator · admin@who.is · +1.555-0100 · Jacksonville, FL, US
Example — one record in snapshots.jsonl for who.is:
{
"snapshot_date": "2018-03-14",
"registrar": "Network Solutions, LLC",
"registrar_iana_id": "2",
"registrar_url": "http://www.networksolutions.com",
"created": "1995-02-09T05:00:00Z",
"updated": "2018-02-08T11:42:01Z",
"expires": "2026-02-08T05:00:00Z",
"name_servers": ["ns1.who.is", "ns2.who.is"],
"statuses": ["clienttransferprohibited"],
"registrant": {
"name": "Domain Administrator",
"org": "who.is",
"email": "admin@who.is",
"phone": "+1.5550100",
"city": "Jacksonville", "state": "FL", "country": "US"
},
"admin": { "name": "Domain Administrator", "email": "admin@who.is" },
"tech": { "name": "Domain Administrator", "email": "admin@who.is" }
}Examples are illustrative; field availability varies by snapshot and era.
$29.00
One-time purchase. We'll email a secure download link (valid 24 hours) once your report is ready.
You'll be redirected to Stripe to complete payment and enter your email for delivery.
We strive to protect privacy and honor applicable privacy laws wherever they apply. If you have a request to remove or delete data, please visit our contact page to get in touch.