DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, and CNAME records for any domain
spastikengellilerfederasyonu.com
DNS Records
DNS Records for spastikengellilerfederasyonu.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| spastikengellilerfederasyonu.com | SOA | 86400 | ceo3.birdns.com hostmaster.cuneyt.com.tr 2026062205 3600 3600 1209600 86400 | |
| spastikengellilerfederasyonu.com | NS | 0 | ceo4.birdns.com | |
| spastikengellilerfederasyonu.com | NS | 0 | ceo3.birdns.com | |
| spastikengellilerfederasyonu.com | A | 0 | 185.9.36.109 | |
| spastikengellilerfederasyonu.com | MX | 0 | 10 | mail.spastikengellilerfederasyonu.com |
| www.spastikengellilerfederasyonu.com | A | 0 | 185.9.36.109 |
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain