DNS Record Lookup
Look up DNS records including A, AAAA, MX, NS, SOA, CNAME, TXT, and CAA records for any domain
freestylefightingacademyreviews.com
DNS Records
Hosting & Network
freestylefightingacademyreviews.com runs on Amazon AWS, with DNS by AWS Route 53 and email configured.
- Hosting network
- Amazon AWSAS16509Amazon AWS
- Managed DNS
- AWS Route 53
- Configured
- IPv6 (AAAA)
- Enabled
- CAA pinning
- None
Sits alongside 4,758,081 other sites on Amazon AWS. Stable here since we started watching (Sep 15, 2026).
DNS Records for freestylefightingacademyreviews.com
| Hostname | Type | TTL | Priority | Content |
|---|---|---|---|---|
| freestylefightingacademyreviews.com | SOA | 86400 | ns-915.awsdns-50.net awsdns-hostmaster.amazon.com 1 7200 900 1209600 86400 | |
| freestylefightingacademyreviews.com | MX | 0 | ||
| freestylefightingacademyreviews.com | NS | 0 | ns-1748.awsdns-26.co.uk | |
| freestylefightingacademyreviews.com | NS | 0 | ns-374.awsdns-46.com | |
| freestylefightingacademyreviews.com | NS | 0 | ns-915.awsdns-50.net | |
| freestylefightingacademyreviews.com | NS | 0 | ns-1522.awsdns-62.org | |
| freestylefightingacademyreviews.com | TXT | 0 | v=spf1 -all | |
| freestylefightingacademyreviews.com | A | 0 | 18.160.46.76 | |
| freestylefightingacademyreviews.com | A | 0 | 18.160.46.46 | |
| freestylefightingacademyreviews.com | A | 0 | 18.160.46.78 | |
| freestylefightingacademyreviews.com | A | 0 | 18.160.46.95 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:8e00:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:ca00:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:7400:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:b800:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:2400:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:1e00:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:a800:a:9627:8140:93a1 | |
| freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:e800:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:3c00:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:1e00:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:2000:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:fe00:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:ca00:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:f400:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:d600:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | AAAA | 0 | 2600:9000:24f3:0:a:9627:8140:93a1 | |
| www.freestylefightingacademyreviews.com | A | 0 | 18.160.46.46 | |
| www.freestylefightingacademyreviews.com | A | 0 | 18.160.46.95 | |
| www.freestylefightingacademyreviews.com | A | 0 | 18.160.46.78 | |
| www.freestylefightingacademyreviews.com | A | 0 | 18.160.46.76 |
Get alerted the moment freestylefightingacademyreviews.com's DNS changes
This page is today's snapshot. Turn on monitoring and we'll watch freestylefightingacademyreviews.com continuously, notifying you the moment anything moves across all three signals:
Uptime
We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.
DNS changes
We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.
TLS certificate
We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.
Free for your first domain: uptime, DNS, and certificate together. No credit card.
What's up with DNS →
Our daily roundup of the most interesting DNS changes across the web — hosting and CDN migrations, network moves, and security-config shifts.
Ask about freestylefightingacademyreviews.com
BetaAnswers use the live DNS records shown on this page. AI-generated — double-check anything important.
About DNS Records
DNS (Domain Name System) records are instructions that provide information about a domain, including its IP addresses, mail servers, and other services. Common record types include:
- SOA (Start of Authority) - Contains administrative information about the zone
- NS (Nameserver) - Specifies authoritative nameservers for the domain
- A (Address) - Maps a domain to an IPv4 address
- AAAA - Maps a domain to an IPv6 address
- CNAME (Canonical Name) - Creates an alias pointing to another domain
- MX (Mail Exchange) - Specifies mail servers for the domain