SSL/TLS Certificate Lookup

Check a domain's SSL/TLS certificate — who issued it, when it expires, and whether the chain is trusted

divinemercypsychiatricfacility.com

SSL/TLS Certificate

SSL/TLS Certificate for divinemercypsychiatricfacility.com

No TLS certificate could be retrieved (TLS handshake timed out).

The domain may not serve HTTPS, may be unreachable, or may not present a certificate on port 443. You can still review its DNS records.

Never get surprised by divinemercypsychiatricfacility.com's certificate expiring

This is today's certificate. Turn on monitoring and we'll watch divinemercypsychiatricfacility.com continuously, notifying you the moment anything moves across all three signals:

Uptime

We visit the site from multiple regions worldwide and email you within minutes if it goes down, with a per-region breakdown so a real outage stands out from a regional blip.

DNS changes

We watch NS, MX, CAA, DNSSEC, CNAME and A/AAAA records, and identify the host, network, and ASN behind them, so a real migration or hijack stands out from routine noise.

TLS certificate

We warn you 30, 14, 7, and 1 days before it expires, and flag it if the issuing authority changes or the certificate is unexpectedly replaced.

Monitor this certificate free

Free for your first domain: uptime, DNS, and certificate together. No credit card.