WHOIS Domain Lookup
Look up registration details, contacts, and nameservers for any domain name
adyalakshmifinancialservices.com
WHOIS Information
The domain adyalakshmifinancialservices.com is registered. You can still try to buy it here.
Registrar Information
- Registrar
- GoDaddy.com, LLC
- WHOIS Server
- whois.godaddy.com
- Referral URL
- http://www.godaddy.com
Important Dates
- Created
- 6/11/2025
- Updated
- 7/14/2025
- Expires
- 6/11/2026
Nameservers
| Hostname | IP Address |
|---|---|
| apollo.dns-parking.com | 162.159.25.42 |
| athena.dns-parking.com | 162.159.24.201 |
Domain Status
- clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
- clientRenewProhibited https://icann.org/epp#clientRenewProhibited
- clientTransferProhibited https://icann.org/epp#clientTransferProhibited
- clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Similar Domains
Raw WHOIS Data
Raw WHOIS responses from registry and registrar servers.
About WHOIS
WHOIS is a query and response protocol used for querying databases that store registered users of Internet resources, including domain names and IP addresses.
The protocol provides essential information about domain ownership, administrative contacts, and technical details that are invaluable for domain management and security purposes.